1NPQ
Structure of a rhodamine-labeled n-domain troponin c mutant (ca2+ saturated) in complex with skeletal troponin i 115-131
PDB DOI: 10.2210/pdb1npq/pdb
Classification: STRUCTURAL PROTEIN Organism(s): Caldanaerobius , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2003-01-18 Deposition Author(s): Corrie, J.E.T. , Ferguson, R.E. , Irving, M. , Mercier, P. , Sykes, B.D. , Trentham, D.R.
Experimental Data Snapshot
Method: SOLUTION NMR Resolution: N.A.
Structure of a rhodamine-labeled n-domain troponin c mutant (ca2+ saturated) in complex with skeletal troponin i 115-131
Corrie, J.E.T. , Ferguson, R.E. , Irving, M. , Mercier, P. , Sykes, B.D. , Trentham, D.R.
Primary Citation of Related Structures: 1NPQ
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Troponin C | A | 90 | Caldanaerobius , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | ASMTDQQAEARAFLSEEMIAEFKAAFDMFDADGGGDISTKELGTVMRMLGQNPTKCELDAIICEVDEDGSGTIDFEEFLVMMVRQMKEDA |
| Troponin I | B | 17 | Caldanaerobius , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | RMSADAMLRALLGSKHK |
Experimental Data
Method: SOLUTION NMR
Deposited Date: 2003-01-18 Deposition Author(s): Corrie, J.E.T. , Ferguson, R.E. , Irving, M. , Mercier, P. , Sykes, B.D. , Trentham, D.R.