Vnd/nk-2 homeodomain/dna complex, nmr, 20 structures
PDB DOI: 10.2210/pdb1nk2/pdb
Classification: DNA BINDING PROTEIN/DNA Organism(s): Drosophila Melanogaster , Synthetic Construct
Deposited: 1998-05-06 Deposition Author(s): Ferretti, J.A. , Gruschus, J.M. , Nirenberg, M. , Tsao, D.H.H. , Wang, L.-H.
Vnd/nk-2 homeodomain/dna complex, nmr, 20 structures
Ferretti, J.A. , Gruschus, J.M. , Nirenberg, M. , Tsao, D.H.H. , Wang, L.-H.
Primary Citation of Related Structures: 1NK2
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| HOMEOBOX PROTEIN VND | P | 77 | Drosophila Melanogaster , Synthetic Construct | ASDGLPNKKRKRRVLFTKAQTYELERRFRQQRYLSAPEREHLASLIRLTPTQVKIWFQNHRYKTKRAQNEKGYEGHP |
Method: SOLUTION NMR
Deposited Date: 1998-05-06 Deposition Author(s): Ferretti, J.A. , Gruschus, J.M. , Nirenberg, M. , Tsao, D.H.H. , Wang, L.-H.