Structure and ubiquitin interactions of the conserved nzf domain of npl4
PDB DOI: 10.2210/pdb1nj3/pdb
Classification: PROTEIN BINDING Organism(s): Rattus Norvegicus
Deposited: 2002-12-30 Deposition Author(s): Alam, S.L. , Davis, D.R. , Meyer, H.H. , Payne, M. , Stemmler, T.L. , Sundquist, W.I. , Wang, B.
Method: SOLUTION NMR Resolution: N.A.
Structure and ubiquitin interactions of the conserved nzf domain of npl4
Alam, S.L. , Davis, D.R. , Meyer, H.H. , Payne, M. , Stemmler, T.L. , Sundquist, W.I. , Wang, B.
Primary Citation of Related Structures: 1NJ3
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| NPL4 | A | 31 | Rattus Norvegicus | GSTSAMWACQHCTFMNQPGTGHCEMCSLPRT |
Method: SOLUTION NMR
Deposited Date: 2002-12-30 Deposition Author(s): Alam, S.L. , Davis, D.R. , Meyer, H.H. , Payne, M. , Stemmler, T.L. , Sundquist, W.I. , Wang, B.