Structure of the coat protein in fd filamentous bacteriophage particles
PDB DOI: 10.2210/pdb1nh4/pdb
Classification: VIRUS Organism(s): Enterobacteria Phage Fd
Deposited: 2002-12-18 Deposition Author(s): Mesleh, M.F. , Nevzorov, A.A. , Opella, S.J. , Zeri, A.C.
Structure of the coat protein in fd filamentous bacteriophage particles
Mesleh, M.F. , Nevzorov, A.A. , Opella, S.J. , Zeri, A.C.
Primary Citation of Related Structures: 1NH4
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Major coat protein | A | 50 | Enterobacteria Phage Fd | AEGDDPAKAAFDSLQASATEMIGYAWAMVVVIVGATIGIKLFKKFTSKAS |
Method: SOLID-STATE NMR
Deposited Date: 2002-12-18 Deposition Author(s): Mesleh, M.F. , Nevzorov, A.A. , Opella, S.J. , Zeri, A.C.