The solution structure of the soluble domain of poliovirus 3a protein
PDB DOI: 10.2210/pdb1ng7/pdb
Classification: VIRAL PROTEIN Organism(s): Uncultured Cyanophage
Deposited: 2002-12-16 Deposition Author(s): Glustrom, L.W. , Strauss, D.M. , Wuttke, D.S.
The solution structure of the soluble domain of poliovirus 3a protein
Glustrom, L.W. , Strauss, D.M. , Wuttke, D.S.
Primary Citation of Related Structures: 1NG7
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Genome polyprotein [Core protein P3A] | A | 60 | Uncultured Cyanophage | MGPLQYKDLKIDIKTSPPPECINDLLQAVDSQEVRDYCEKKGWIVNITSQVQTERNINRA |
Genome polyprotein [Core protein P3A] | B | 60 | Uncultured Cyanophage | MGPLQYKDLKIDIKTSPPPECINDLLQAVDSQEVRDYCEKKGWIVNITSQVQTERNINRA |
Method: SOLUTION NMR
Deposited Date: 2002-12-16 Deposition Author(s): Glustrom, L.W. , Strauss, D.M. , Wuttke, D.S.