1NE3
Solution structure of ribosomal protein s28e from methanobacterium thermoautotrophicum. ontario centre for structural proteomics target mth0256_1_68; northeast structural genomics target tt744
PDB DOI: 10.2210/pdb1ne3/pdb
Classification: RIBOSOME Organism(s): Methanothermococcus Thermolithotrophicus
Deposited: 2002-12-10 Deposition Author(s): Arrowsmith, C.H. , Cort, J.R. , Edwards, A. , Kennedy, M. , Northeast Structural Genomics Consortium (Nesg) , Pineda-Lucena, A. , Ramelot, T.A. , Wu, B. , Yee, A.
Experimental Data Snapshot
Method: SOLUTION NMR Resolution: N.A.
Solution structure of ribosomal protein s28e from methanobacterium thermoautotrophicum. ontario centre for structural proteomics target mth0256_1_68; northeast structural genomics target tt744
Arrowsmith, C.H. , Cort, J.R. , Edwards, A. , Kennedy, M. , Northeast Structural Genomics Consortium (Nesg) , Pineda-Lucena, A. , Ramelot, T.A. , Wu, B. , Yee, A.
Primary Citation of Related Structures: 1NE3
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| 30S ribosomal protein S28E | A | 68 | Methanothermococcus Thermolithotrophicus | MDDATPAEVIEVLKRTGMTGEVMQVKCRILDGRDKGRILTRNVMGPIREGDILMLLDTIREAKEIRTP |
Experimental Data
Method: SOLUTION NMR
Deposited Date: 2002-12-10 Deposition Author(s): Arrowsmith, C.H. , Cort, J.R. , Edwards, A. , Kennedy, M. , Northeast Structural Genomics Consortium (Nesg) , Pineda-Lucena, A. , Ramelot, T.A. , Wu, B. , Yee, A.