Nmr structures of the zinc finger domain of human dna polymerase-alpha
PDB DOI: 10.2210/pdb1n5g/pdb
Classification: TRANSFERASE Organism(s): N.A.
Deposited: 2002-11-05 Deposition Author(s): Bose, R.N. , Evanics, F. , Maurmann, L. , Yang, W.W.
Nmr structures of the zinc finger domain of human dna polymerase-alpha
Bose, R.N. , Evanics, F. , Maurmann, L. , Yang, W.W.
Primary Citation of Related Structures: 1N5G
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
38-mer of DNA polymerase alpha catalytic subunit | A | 38 | N.A. | WLICEEPTCRNRTRHLPLQFSRTGPLCPACMKATLQPE |
Method: SOLUTION NMR
Deposited Date: 2002-11-05 Deposition Author(s): Bose, R.N. , Evanics, F. , Maurmann, L. , Yang, W.W.