Structure of the plant defensin phd1 from petunia hybrida
PDB DOI: 10.2210/pdb1n4n/pdb
Classification: PLANT PROTEIN Organism(s): Arthrobacter Sp. U41
Deposited: 2002-11-01 Deposition Author(s): Anderson, M.A. , Craik, D.J. , Janssen, B.J.C. , Lay, F.T. , Schirra, H.J.
Method: SOLUTION NMR Resolution: N.A.
Structure of the plant defensin phd1 from petunia hybrida
Anderson, M.A. , Craik, D.J. , Janssen, B.J.C. , Lay, F.T. , Schirra, H.J.
Primary Citation of Related Structures: 1N4N
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
floral defensin-like protein 1 | A | 47 | Arthrobacter Sp. U41 | ATCKAECPTWDSVCINKKPCVACCKKAKFSDGHCSKILRRCLCTKEC |
Method: SOLUTION NMR
Deposited Date: 2002-11-01 Deposition Author(s): Anderson, M.A. , Craik, D.J. , Janssen, B.J.C. , Lay, F.T. , Schirra, H.J.