Nmr structure of the fd bacteriophage pviii coat protein in lipid bilayer membranes
PDB DOI: 10.2210/pdb1mzt/pdb
Classification: VIRAL PROTEIN Organism(s): Enterobacteria Phage Fd
Deposited: 2002-10-09 Deposition Author(s): Marassi, F.M. , Opella, S.J.
Method: SOLID-STATE NMR Resolution: N.A.
Nmr structure of the fd bacteriophage pviii coat protein in lipid bilayer membranes
Primary Citation of Related Structures: 1MZT
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| major coat protein pVIII | A | 50 | Enterobacteria Phage Fd | AEGDDPAKAAFDSLQASATEYIGYAWAMVVVIVGATIGIKLFKKFTSKAS |
Method: SOLID-STATE NMR
Deposited Date: 2002-10-09 Deposition Author(s): Marassi, F.M. , Opella, S.J.