Storage function of comp:the crystal structure of the coiled-coil domain in complex with vitamin d3
PDB DOI: 10.2210/pdb1mz9/pdb
Classification: PROTEIN BINDING Organism(s): Mus Musculus
Deposited: 2002-10-07 Deposition Author(s): Stetefeld, J.
Method: X-RAY DIFFRACTION Resolution: 1.7 Å
Storage function of comp:the crystal structure of the coiled-coil domain in complex with vitamin d3
Primary Citation of Related Structures: 1MZ9
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| cartilage oligomeric matrix protein | A | 45 | Mus Musculus | MDLAPQMLRELQETNAALQDVRELLRQQVKEITFLKNTVMECDAC |
| cartilage oligomeric matrix protein | B | 45 | Mus Musculus | MDLAPQMLRELQETNAALQDVRELLRQQVKEITFLKNTVMECDAC |
| cartilage oligomeric matrix protein | C | 45 | Mus Musculus | MDLAPQMLRELQETNAALQDVRELLRQQVKEITFLKNTVMECDAC |
| cartilage oligomeric matrix protein | D | 45 | Mus Musculus | MDLAPQMLRELQETNAALQDVRELLRQQVKEITFLKNTVMECDAC |
| cartilage oligomeric matrix protein | E | 45 | Mus Musculus | MDLAPQMLRELQETNAALQDVRELLRQQVKEITFLKNTVMECDAC |
Method: X-RAY DIFFRACTION
Deposited Date: 2002-10-07 Deposition Author(s): Stetefeld, J.