Crystal structure of a mug-dna pseudo substrate complex
PDB DOI: 10.2210/pdb1mwj/pdb
Classification: HYDROLASE/DNA Organism(s): Escherichia Coli , Synthetic Construct
Deposited: 2002-09-30 Deposition Author(s): Barrett, T.E. , Brown, T. , Jiricny, J. , Pearl, L.H. , Savva, R. , Scharer, O. , Verdine, G.L.
Method: X-RAY DIFFRACTION Resolution: 2.85 Å
Crystal structure of a mug-dna pseudo substrate complex
Barrett, T.E. , Brown, T. , Jiricny, J. , Pearl, L.H. , Savva, R. , Scharer, O. , Verdine, G.L.
Primary Citation of Related Structures: 1MWJ
| Nucleic Acids / Hybrid | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| 5'-D(*CP*GP*CP*GP*A*GP*(DU)P*TP*CP*GP*CP*G)-3' | d | 12 | NA | CGCGAGUTCGCG |
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| G/U mismatch-specific DNA glycosylase | A | 168 | Escherichia Coli , Synthetic Construct | MVEDILAPGLRVVFCGINPGLSSAGTGFPFAHPANRFWKVIYQAGFTDRQLKPQEAQHLLDYRCGVTKLVDRPTVQANEVSKQELHAGGRKLIEKIEDYQPQALAILGKQAYEQGFSQRGAQWGKQTLTIGSTQIWVLPNPSGLSRVSLEKLVEAYRELDQALVVRGR |
Method: X-RAY DIFFRACTION
Deposited Date: 2002-09-30 Deposition Author(s): Barrett, T.E. , Brown, T. , Jiricny, J. , Pearl, L.H. , Savva, R. , Scharer, O. , Verdine, G.L.