1MW4
Solution structure of the human grb7-sh2 domain in complex with a 10 amino acid peptide py1139
PDB DOI: 10.2210/pdb1mw4/pdb
Classification: HORMONE/GROWTH FACTOR/TRANSFERASE Organism(s): Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2002-09-27 Deposition Author(s): Ivancic, M. , Lyons, B.A.
Experimental Data Snapshot
Method: SOLUTION NMR Resolution: N.A.
Solution structure of the human grb7-sh2 domain in complex with a 10 amino acid peptide py1139
Primary Citation of Related Structures: 1MW4
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Growth factor receptor-bound protein 7 | A | 120 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | GSPASGTSLSAAIHRTQLWFHGRISREESQRLIGQQGLVDGLFLVRESQRNPQGFVLSLCHLQKVKHYLILPSEEEGRLYFSMDDGQTRFTDLLQLVEFHQLNRGILPCLLRHCCTRVAL |
| Receptor protein-tyrosine kinase erbB-2 | B | 10 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | PQPEYVNQPD |
Experimental Data
Method: SOLUTION NMR
Deposited Date: 2002-09-27 Deposition Author(s): Ivancic, M. , Lyons, B.A.