Viability of a drug-resistant hiv-1 protease mutant: structural insights for better antiviral therapy
PDB DOI: 10.2210/pdb1mt8/pdb
Classification: HYDROLASE/HYDROLASE SUBSTRATE Organism(s): Anoxybacillus Sp. Lm18-11 , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2002-09-20 Deposition Author(s): King, N.M. , Nalivaika, E.A. , Prabu-Jeyabalan, M. , Schiffer, C.A.
Viability of a drug-resistant hiv-1 protease mutant: structural insights for better antiviral therapy
King, N.M. , Nalivaika, E.A. , Prabu-Jeyabalan, M. , Schiffer, C.A.
Primary Citation of Related Structures: 1MT8
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
PROTEASE RETROPEPSIN | A | 99 | Anoxybacillus Sp. Lm18-11 , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | PQITLWKRPLVTIRIGGQLKEALLNTGADDTVLEEMNLPGKWKPKMIGGIGGFIKVRQYDQIPVEICGHKAIGTVLVGPTPANIIGRNLLTQIGCTLNF |
PROTEASE RETROPEPSIN | B | 99 | Anoxybacillus Sp. Lm18-11 , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | PQITLWKRPLVTIRIGGQLKEALLNTGADDTVLEEMNLPGKWKPKMIGGIGGFIKVRQYDQIPVEICGHKAIGTVLVGPTPANIIGRNLLTQIGCTLNF |
Capsid-p2 substrate peptide of HIV-1 Gag polyprotein | P | 10 | Anoxybacillus Sp. Lm18-11 , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | KARVLAEAMS |
Method: X-RAY DIFFRACTION
Deposited Date: 2002-09-20 Deposition Author(s): King, N.M. , Nalivaika, E.A. , Prabu-Jeyabalan, M. , Schiffer, C.A.