Nmr solution structure of native viperidae lebetina obtusa protein
PDB DOI: 10.2210/pdb1mpz/pdb
Classification: HYDROLASE Organism(s): Escherichia Coli O6:K15:H31 (Strain 536 / Upec)
Deposited: 2002-09-13 Deposition Author(s): Calvete, J.J. , Celda, B. , Marcinkiewicz, C. , Monleon, D. , Moreno-Murciano, M.P.
Nmr solution structure of native viperidae lebetina obtusa protein
Calvete, J.J. , Celda, B. , Marcinkiewicz, C. , Monleon, D. , Moreno-Murciano, M.P.
Primary Citation of Related Structures: 1MPZ
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Obtustatin | A | 41 | Escherichia Coli O6:K15:H31 (Strain 536 / Upec) | CTTGPCCRQCKLKPAGTTCWKTSLTSHYCTGKSCDCPLYPG |
Method: SOLUTION NMR
Deposited Date: 2002-09-13 Deposition Author(s): Calvete, J.J. , Celda, B. , Marcinkiewicz, C. , Monleon, D. , Moreno-Murciano, M.P.