Solution structure of the 2nd phd domain from mi2b with c-terminal loop replaced by corresponding loop from wstf
PDB DOI: 10.2210/pdb1mm3/pdb
Classification: DNA binding protein/Transcription Organism(s): Homo Sapiens
Deposited: 2002-09-02 Deposition Author(s): Crossley, M. , Gell, D.A. , Kwan, A.H.Y. , Mackay, J.P. , Matthews, J.M. , Verger, A.
Solution structure of the 2nd phd domain from mi2b with c-terminal loop replaced by corresponding loop from wstf
Crossley, M. , Gell, D.A. , Kwan, A.H.Y. , Mackay, J.P. , Matthews, J.M. , Verger, A.
Primary Citation of Related Structures: 1MM3
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Mi2-beta(Chromodomain helicase-DNA-binding protein 4) and transcription factor WSTF | A | 61 | Homo Sapiens | GPLGSDHHMEFCRVCKDGGELLCCDTCPSSYHIHCLRPALYEVPDGEWQCPRCTCPALKGK |
Method: SOLUTION NMR
Deposited Date: 2002-09-02 Deposition Author(s): Crossley, M. , Gell, D.A. , Kwan, A.H.Y. , Mackay, J.P. , Matthews, J.M. , Verger, A.