Solution structure of termicin, an antimicrobial peptide from the termite pseudacanthotermes spiniger
PDB DOI: 10.2210/pdb1mm0/pdb
Classification: ANTIMICROBIAL PROTEIN Organism(s): Pseudacanthotermes Spiniger
Deposited: 2002-09-02 Deposition Author(s): Bulet, P. , Caille, A. , Da Silva, P. , Jouvensal, L. , Lamberty, M. , Vovelle, F.
Method: SOLUTION NMR Resolution: N.A.
Solution structure of termicin, an antimicrobial peptide from the termite pseudacanthotermes spiniger
Bulet, P. , Caille, A. , Da Silva, P. , Jouvensal, L. , Lamberty, M. , Vovelle, F.
Primary Citation of Related Structures: 1MM0
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Termicin | A | 36 | Pseudacanthotermes Spiniger | ACNFQSCWATCQAQHSIYFRRAFCDRSQCKCVFVRG |
Method: SOLUTION NMR
Deposited Date: 2002-09-02 Deposition Author(s): Bulet, P. , Caille, A. , Da Silva, P. , Jouvensal, L. , Lamberty, M. , Vovelle, F.