Three-dimensional solution structure of an insulin dimer. a study of the b9(asp) mutant of human insulin using nuclear magnetic resonance distance geometry and restrained molecular dynamics
PDB DOI: 10.2210/pdb1mhi/pdb
Classification: HORMONE Organism(s): Homo Sapiens
Deposited: 1994-11-30 Deposition Author(s): Balschmidt, P. , Jorgensen, A.M.M. , Kristensen, S.M. , Led, J.J.
Three-dimensional solution structure of an insulin dimer. a study of the b9(asp) mutant of human insulin using nuclear magnetic resonance distance geometry and restrained molecular dynamics
Balschmidt, P. , Jorgensen, A.M.M. , Kristensen, S.M. , Led, J.J.
Primary Citation of Related Structures: 1MHI
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| INSULIN | A | 21 | Homo Sapiens | GIVEQCCTSICSLYQLENYCN |
| INSULIN | B | 30 | Homo Sapiens | FVNQHLCGDHLVEALYLVCGERGFFYTPKT |
Method: SOLUTION NMR
Deposited Date: 1994-11-30 Deposition Author(s): Balschmidt, P. , Jorgensen, A.M.M. , Kristensen, S.M. , Led, J.J.