Three dimensional solution structure of huwentoxin-iv by 2d 1h-nmr
PDB DOI: 10.2210/pdb1mb6/pdb
Classification: TOXIN Organism(s): Ornithoctonus Huwena
Deposited: 2002-08-02 Deposition Author(s): Liang, S.P. , Peng, K. , Shu, Q.
Method: SOLUTION NMR Resolution: N.A.
Three dimensional solution structure of huwentoxin-iv by 2d 1h-nmr
Liang, S.P. , Peng, K. , Shu, Q.
Primary Citation of Related Structures: 1MB6
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| huwentoxin-iv | A | 35 | Ornithoctonus Huwena | ECLEIFKACNPSNDQCCKSSKLVCSRKTRWCKYQI |
Method: SOLUTION NMR
Deposited Date: 2002-08-02 Deposition Author(s): Liang, S.P. , Peng, K. , Shu, Q.