Solution structure of a cchc zinc finger from moz
PDB DOI: 10.2210/pdb1m36/pdb
Classification: DNA BINDING PROTEIN Organism(s): Homo Sapiens
Deposited: 2002-06-27 Deposition Author(s): Gell, D.A. , Kwan, A.H.Y. , Liew, C.K. , Mackay, J.P.
Solution structure of a cchc zinc finger from moz
Gell, D.A. , Kwan, A.H.Y. , Liew, C.K. , Mackay, J.P.
Primary Citation of Related Structures: 1M36
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Monocytic leukemia zinc finger protein | A | 33 | Homo Sapiens | GSRLPKLYLCEFCLKYMKSRTILQQHMKKCGWF |
Method: SOLUTION NMR
Deposited Date: 2002-06-27 Deposition Author(s): Gell, D.A. , Kwan, A.H.Y. , Liew, C.K. , Mackay, J.P.