PDBi (Protein Data Bank in India)

All in One Protein Databank
Home About Help Resources External Links Contact Us
Advanced Search
FASTA Sequence PDB Format mmCIF Format
FASTA Sequence PDB Format PDB Format(gz) PDBx/mmCIF Format PDBx/mmCIF Format(gz) PDBML/XML Format Validation Full PDF Validation CIF

1M07

Residues involved in the catalysis and base specificity of cytotoxic ribonuclease from bullfrog (rana catesbeiana)

PDB DOI: 10.2210/pdb1m07/pdb

Classification: HYDROLASE/DNA
Organism(s): Pseudomonas Sp. Vm15C , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)

Deposited: 2002-06-12
Deposition Author(s): Amiraslanov, I. , Chern, S.-S. , Hsiao, Y.-Y. , Leu, Y.-J. , Liao, Y.-D. , Liaw, Y.-C. , Wang, S.-C.

Experimental Data Snapshot

Method: X-RAY DIFFRACTION
Resolution: 1.8 Å

Literature

Residues involved in the catalysis and base specificity of cytotoxic ribonuclease from bullfrog (rana catesbeiana)

Amiraslanov, I. , Chern, S.-S. , Hsiao, Y.-Y. , Leu, Y.-J. , Liao, Y.-D. , Liaw, Y.-C. , Wang, S.-C.

Primary Citation of Related Structures: 1M07


Nucleic Acids / Hybrid
Molecule Chains Sequence Length Organism Sequence
5'-D(*AP*CP*GP*A)-3' c 4 NA ACGA
5'-D(*AP*CP*GP*A)-3' d 4 NA ACGA

Proteins
Molecule Chains Sequence Length Organism Sequence
Ribonuclease A 111 Pseudomonas Sp. Vm15C , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) QNWATFQQKHIINTPIINCNTIMDNNIYIVGGQCKRVNTFIISSATTVKAICTGVINMNVLSTTRFQLNTCTRTSITPRPCPYSSRTETNYICVKCENQYPVHFAGIGRCP
Ribonuclease B 111 Pseudomonas Sp. Vm15C , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) QNWATFQQKHIINTPIINCNTIMDNNIYIVGGQCKRVNTFIISSATTVKAICTGVINMNVLSTTRFQLNTCTRTSITPRPCPYSSRTETNYICVKCENQYPVHFAGIGRCP
Experimental Data

Method: X-RAY DIFFRACTION

Deposited Date: 2002-06-12
Deposition Author(s): Amiraslanov, I. , Chern, S.-S. , Hsiao, Y.-Y. , Leu, Y.-J. , Liao, Y.-D. , Liaw, Y.-C. , Wang, S.-C.