Solution structure of a toxin (gsmtx2) from the tarantula, grammostola spatulata, which inhibits mechanosensitive ion channels
PDB DOI: 10.2210/pdb1lup/pdb
Classification: TOXIN Organism(s): Thermoascus Aurantiacus Atcc 26904
Deposited: 2002-05-23 Deposition Author(s): Gottlieb, P. , Mcfeeters, R. , Oswald, R.E. , Sachs, F. , Suchyna, T.M.
Method: SOLUTION NMR Resolution: N.A.
Solution structure of a toxin (gsmtx2) from the tarantula, grammostola spatulata, which inhibits mechanosensitive ion channels
Gottlieb, P. , Mcfeeters, R. , Oswald, R.E. , Sachs, F. , Suchyna, T.M.
Primary Citation of Related Structures: 1LUP
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
GsMTx2 | A | 31 | Thermoascus Aurantiacus Atcc 26904 | YCQKWMWTCDEERKCCEGLVCRLWCKRIINM |
Method: SOLUTION NMR
Deposited Date: 2002-05-23 Deposition Author(s): Gottlieb, P. , Mcfeeters, R. , Oswald, R.E. , Sachs, F. , Suchyna, T.M.