Crystal structure of a methanobacterial sm-like archaeal protein (smap1) bound to uridine-5'-monophosphate (ump)
PDB DOI: 10.2210/pdb1loj/pdb
Classification: RNA BINDING PROTEIN, transcription Organism(s): Methanothermobacter Thermautotrophicus Str. Delta H
Deposited: 2002-05-06 Deposition Author(s): Eisenberg, D. , Kozhukhovsky, A. , Mura, C.
Crystal structure of a methanobacterial sm-like archaeal protein (smap1) bound to uridine-5'-monophosphate (ump)
Eisenberg, D. , Kozhukhovsky, A. , Mura, C.
Primary Citation of Related Structures: 1LOJ
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
small nuclear ribonucleoprotein homolog (Sm-like) | A | 87 | Methanothermobacter Thermautotrophicus Str. Delta H | MIDVSSQRVNVQRPLDALGNSLNSPVIIKLKGDREFRGVLKSFDLHMNLVLNDAEELEDGEVTRRLGTVLIRGDNIVYISRGKLAAA |
small nuclear ribonucleoprotein homolog (Sm-like) | B | 87 | Methanothermobacter Thermautotrophicus Str. Delta H | MIDVSSQRVNVQRPLDALGNSLNSPVIIKLKGDREFRGVLKSFDLHMNLVLNDAEELEDGEVTRRLGTVLIRGDNIVYISRGKLAAA |
small nuclear ribonucleoprotein homolog (Sm-like) | C | 87 | Methanothermobacter Thermautotrophicus Str. Delta H | MIDVSSQRVNVQRPLDALGNSLNSPVIIKLKGDREFRGVLKSFDLHMNLVLNDAEELEDGEVTRRLGTVLIRGDNIVYISRGKLAAA |
small nuclear ribonucleoprotein homolog (Sm-like) | D | 87 | Methanothermobacter Thermautotrophicus Str. Delta H | MIDVSSQRVNVQRPLDALGNSLNSPVIIKLKGDREFRGVLKSFDLHMNLVLNDAEELEDGEVTRRLGTVLIRGDNIVYISRGKLAAA |
small nuclear ribonucleoprotein homolog (Sm-like) | E | 87 | Methanothermobacter Thermautotrophicus Str. Delta H | MIDVSSQRVNVQRPLDALGNSLNSPVIIKLKGDREFRGVLKSFDLHMNLVLNDAEELEDGEVTRRLGTVLIRGDNIVYISRGKLAAA |
small nuclear ribonucleoprotein homolog (Sm-like) | F | 87 | Methanothermobacter Thermautotrophicus Str. Delta H | MIDVSSQRVNVQRPLDALGNSLNSPVIIKLKGDREFRGVLKSFDLHMNLVLNDAEELEDGEVTRRLGTVLIRGDNIVYISRGKLAAA |
small nuclear ribonucleoprotein homolog (Sm-like) | G | 87 | Methanothermobacter Thermautotrophicus Str. Delta H | MIDVSSQRVNVQRPLDALGNSLNSPVIIKLKGDREFRGVLKSFDLHMNLVLNDAEELEDGEVTRRLGTVLIRGDNIVYISRGKLAAA |
small nuclear ribonucleoprotein homolog (Sm-like) | H | 87 | Methanothermobacter Thermautotrophicus Str. Delta H | MIDVSSQRVNVQRPLDALGNSLNSPVIIKLKGDREFRGVLKSFDLHMNLVLNDAEELEDGEVTRRLGTVLIRGDNIVYISRGKLAAA |
small nuclear ribonucleoprotein homolog (Sm-like) | I | 87 | Methanothermobacter Thermautotrophicus Str. Delta H | MIDVSSQRVNVQRPLDALGNSLNSPVIIKLKGDREFRGVLKSFDLHMNLVLNDAEELEDGEVTRRLGTVLIRGDNIVYISRGKLAAA |
small nuclear ribonucleoprotein homolog (Sm-like) | J | 87 | Methanothermobacter Thermautotrophicus Str. Delta H | MIDVSSQRVNVQRPLDALGNSLNSPVIIKLKGDREFRGVLKSFDLHMNLVLNDAEELEDGEVTRRLGTVLIRGDNIVYISRGKLAAA |
small nuclear ribonucleoprotein homolog (Sm-like) | K | 87 | Methanothermobacter Thermautotrophicus Str. Delta H | MIDVSSQRVNVQRPLDALGNSLNSPVIIKLKGDREFRGVLKSFDLHMNLVLNDAEELEDGEVTRRLGTVLIRGDNIVYISRGKLAAA |
small nuclear ribonucleoprotein homolog (Sm-like) | L | 87 | Methanothermobacter Thermautotrophicus Str. Delta H | MIDVSSQRVNVQRPLDALGNSLNSPVIIKLKGDREFRGVLKSFDLHMNLVLNDAEELEDGEVTRRLGTVLIRGDNIVYISRGKLAAA |
small nuclear ribonucleoprotein homolog (Sm-like) | M | 87 | Methanothermobacter Thermautotrophicus Str. Delta H | MIDVSSQRVNVQRPLDALGNSLNSPVIIKLKGDREFRGVLKSFDLHMNLVLNDAEELEDGEVTRRLGTVLIRGDNIVYISRGKLAAA |
small nuclear ribonucleoprotein homolog (Sm-like) | N | 87 | Methanothermobacter Thermautotrophicus Str. Delta H | MIDVSSQRVNVQRPLDALGNSLNSPVIIKLKGDREFRGVLKSFDLHMNLVLNDAEELEDGEVTRRLGTVLIRGDNIVYISRGKLAAA |
Method: X-RAY DIFFRACTION
Deposited Date: 2002-05-06 Deposition Author(s): Eisenberg, D. , Kozhukhovsky, A. , Mura, C.