Nmr solution structure of the extended pbx homeodomain bound to dna
PDB DOI: 10.2210/pdb1lfu/pdb
Classification: TRANSCRIPTION Organism(s): Enterobacter Aerogenes , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2002-04-12 Deposition Author(s): Featherstone, M. , Gehring, K. , Green, N. , Sprules, T.
Nmr solution structure of the extended pbx homeodomain bound to dna
Featherstone, M. , Gehring, K. , Green, N. , Sprules, T.
Primary Citation of Related Structures: 1LFU
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
homeobox protein PBX1 | P | 82 | Enterobacter Aerogenes , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | MARRKRRNFNKQATEILNEYFYSHLSNPYPSEEAKEELAKKSGITVSQVSNWFGNKRIRYKKNIGKFQEEANIYAAKTAVTA |
Method: SOLUTION NMR
Deposited Date: 2002-04-12 Deposition Author(s): Featherstone, M. , Gehring, K. , Green, N. , Sprules, T.