Structure of the complex of lac repressor headpiece and an 11 base-pair half-operator determined by nuclear magnetic resonance spectroscopy and restrained molecular dynamics
PDB DOI: 10.2210/pdb1lcd/pdb
Classification: GENE REGULATION/DNA Organism(s): Escherichia Coli , Synthetic Construct
Deposited: 1993-03-25 Deposition Author(s): Boelens, R. , Chuprina, V.P. , Kaptein, R. , Lamerichs, R.M.J.N. , Rullmann, J.A.C. , Van Boom, J.H.
Structure of the complex of lac repressor headpiece and an 11 base-pair half-operator determined by nuclear magnetic resonance spectroscopy and restrained molecular dynamics
Boelens, R. , Chuprina, V.P. , Kaptein, R. , Lamerichs, R.M.J.N. , Rullmann, J.A.C. , Van Boom, J.H.
Primary Citation of Related Structures: 1LCD
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Lac Repressor | A | 51 | Escherichia Coli , Synthetic Construct | MKPVTLYDVAEYAGVSYQTVSRVVNQASHVSAKTREKVEAAMAELNYIPNR |
Method: SOLUTION NMR
Deposited Date: 1993-03-25 Deposition Author(s): Boelens, R. , Chuprina, V.P. , Kaptein, R. , Lamerichs, R.M.J.N. , Rullmann, J.A.C. , Van Boom, J.H.