Solution structure of a dimer of lac repressor dna-binding domain complexed to its natural operator o1
PDB DOI: 10.2210/pdb1l1m/pdb
Classification: TRANSCRIPTION REGULATOR/DNA Organism(s): Escherichia Coli , Synthetic Construct
Deposited: 2002-02-19 Deposition Author(s): Boelens, R. , Bonvin, A.M.J.J. , Kalodimos, C.G. , Kaptein, R. , Salinas, R.K. , Wechselberger, R.
Solution structure of a dimer of lac repressor dna-binding domain complexed to its natural operator o1
Boelens, R. , Bonvin, A.M.J.J. , Kalodimos, C.G. , Kaptein, R. , Salinas, R.K. , Wechselberger, R.
Primary Citation of Related Structures: 1L1M
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Lactose operon repressor | A | 62 | Escherichia Coli , Synthetic Construct | MKPVTLYDVAEYAGVSYQTVSRVVNQASHVSAKTREKVEAAMAELNYIPNRCAQQLAGKQSL |
Lactose operon repressor | B | 62 | Escherichia Coli , Synthetic Construct | MKPVTLYDVAEYAGVSYQTVSRVVNQASHVSAKTREKVEAAMAELNYIPNRCAQQLAGKQSL |
Method: SOLUTION NMR
Deposited Date: 2002-02-19 Deposition Author(s): Boelens, R. , Bonvin, A.M.J.J. , Kalodimos, C.G. , Kaptein, R. , Salinas, R.K. , Wechselberger, R.