Structure of the lict bacterial antiterminator protein in complex with its rna target
PDB DOI: 10.2210/pdb1l1c/pdb
Classification: TRANSCRIPTION/RNA Organism(s): Bacillus Subtilis , Synthetic Construct
Deposited: 2002-02-15 Deposition Author(s): Aymerich, S. , Declerck, N. , Kochoyan, M. , Manival, X. , Yang, Y.
Method: SOLUTION NMR Resolution: N.A.
Structure of the lict bacterial antiterminator protein in complex with its rna target
Aymerich, S. , Declerck, N. , Kochoyan, M. , Manival, X. , Yang, Y.
Primary Citation of Related Structures: 1L1C
| Nucleic Acids / Hybrid | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| licT mRNA antiterminator hairpin | c | 29 | NA | GGAUUGUUACUGCUACGGCAGGCAAAACC |
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Transcription antiterminator licT | A | 55 | Bacillus Subtilis , Synthetic Construct | MKIAKVINNNVISVVNEQGKELVVMGRGLAFQKKSGDDVDEARIEKVFTLDNKDV |
| Transcription antiterminator licT | B | 55 | Bacillus Subtilis , Synthetic Construct | MKIAKVINNNVISVVNEQGKELVVMGRGLAFQKKSGDDVDEARIEKVFTLDNKDV |
Method: SOLUTION NMR
Deposited Date: 2002-02-15 Deposition Author(s): Aymerich, S. , Declerck, N. , Kochoyan, M. , Manival, X. , Yang, Y.