Structure of the lict bacterial antiterminator protein in complex with its rna target
PDB DOI: 10.2210/pdb1l1c/pdb
Classification: TRANSCRIPTION/RNA Organism(s): Tomato Spotted Wilt Virus (Strain Bulgarian L3) , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2002-02-15 Deposition Author(s): Aymerich, S. , Declerck, N. , Kochoyan, M. , Manival, X. , Yang, Y.
Structure of the lict bacterial antiterminator protein in complex with its rna target
Aymerich, S. , Declerck, N. , Kochoyan, M. , Manival, X. , Yang, Y.
Primary Citation of Related Structures: 1L1C
Nucleic Acids / Hybrid | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
licT mRNA antiterminator hairpin | c | 29 | NA | GGAUUGUUACUGCUACGGCAGGCAAAACC |
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Transcription antiterminator licT | A | 55 | Tomato Spotted Wilt Virus (Strain Bulgarian L3) , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | MKIAKVINNNVISVVNEQGKELVVMGRGLAFQKKSGDDVDEARIEKVFTLDNKDV |
Transcription antiterminator licT | B | 55 | Tomato Spotted Wilt Virus (Strain Bulgarian L3) , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | MKIAKVINNNVISVVNEQGKELVVMGRGLAFQKKSGDDVDEARIEKVFTLDNKDV |
Method: SOLUTION NMR
Deposited Date: 2002-02-15 Deposition Author(s): Aymerich, S. , Declerck, N. , Kochoyan, M. , Manival, X. , Yang, Y.