Family of 30 conformers of a mono-heme ferrocytochrome c from shewanella putrefaciens solved by nmr
PDB DOI: 10.2210/pdb1kx7/pdb
Classification: OXYGEN STORAGE/TRANSPORT Organism(s): Streptococcus Gordonii (Strain Challis / Atcc 35105 / Bcrc 15272 / Ch1 / Dl1 / V288)
Deposited: 2002-01-31 Deposition Author(s): Bartalesi, I. , Bertini, I. , Hajieva, P. , Rosato, A. , Vasos, P.R.
Family of 30 conformers of a mono-heme ferrocytochrome c from shewanella putrefaciens solved by nmr
Bartalesi, I. , Bertini, I. , Hajieva, P. , Rosato, A. , Vasos, P.R.
Primary Citation of Related Structures: 1KX7
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
mono-heme c-type cytochrome ScyA | A | 81 | Streptococcus Gordonii (Strain Challis / Atcc 35105 / Bcrc 15272 / Ch1 / Dl1 / V288) | ADLQDAEAIYNKACTVCHSMGVAGAPKSHNTADWEPRLAKGVDNLVKSVKTGLNAMPPGGMCTDCTDEDYKAAIEFMSKAK |
Method: SOLUTION NMR
Deposited Date: 2002-01-31 Deposition Author(s): Bartalesi, I. , Bertini, I. , Hajieva, P. , Rosato, A. , Vasos, P.R.