Kaliotoxin (1-37) shows structural differences with related potassium channel blockers
PDB DOI: 10.2210/pdb1ktx/pdb
Classification: NEUROTOXIN(POTASSIUM CHANNEL INHIBITOR) Organism(s): Androctonus Mauretanicus Mauretanicus
Deposited: 1994-06-02 Deposition Author(s): Fernandez, I. , Giralt, E. , Martin-Eauclaire, M.-F. , Pons, M. , Rochat, H. , Romi, R. , Szendefi, S. , Van Rietschtoten, J.
Kaliotoxin (1-37) shows structural differences with related potassium channel blockers
Fernandez, I. , Giralt, E. , Martin-Eauclaire, M.-F. , Pons, M. , Rochat, H. , Romi, R. , Szendefi, S. , Van Rietschtoten, J.
Primary Citation of Related Structures: 1KTX
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| KALIOTOXIN | A | 38 | Androctonus Mauretanicus Mauretanicus | GVEINVKCSGSPQCLKPCKDAGMRFGKCMNRKCHCTPX |
Method: SOLUTION NMR
Deposited Date: 1994-06-02 Deposition Author(s): Fernandez, I. , Giralt, E. , Martin-Eauclaire, M.-F. , Pons, M. , Rochat, H. , Romi, R. , Szendefi, S. , Van Rietschtoten, J.