The first fibronectin type ii module from human matrix metalloproteinase 2
PDB DOI: 10.2210/pdb1ks0/pdb
Classification: HYDROLASE Organism(s): Homo Sapiens
Deposited: 2002-01-10 Deposition Author(s): Banyai, L. , Briknarova, K. , Gehrmann, M. , Llinas, M. , Patthy, L.
The first fibronectin type ii module from human matrix metalloproteinase 2
Banyai, L. , Briknarova, K. , Gehrmann, M. , Llinas, M. , Patthy, L.
Primary Citation of Related Structures: 1KS0
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Matrix Metalloproteinase 2 | A | 63 | Homo Sapiens | RIPVKYGNADGEYCKFPFLFNGKEYNSCTDTGRSDGFLWCSTTYNFEKDGKYGFCPHEALFTM |
Method: SOLUTION NMR
Deposited Date: 2002-01-10 Deposition Author(s): Banyai, L. , Briknarova, K. , Gehrmann, M. , Llinas, M. , Patthy, L.