Crystal structure of the c-terminal region of striated muscle alpha-tropomyosin at 2.7 angstrom resolution
PDB DOI: 10.2210/pdb1kql/pdb
Classification: CONTRACTILE PROTEIN Organism(s): Rattus Norvegicus , Saccharomyces Cerevisiae
Deposited: 2002-01-07 Deposition Author(s): Brown, J.H. , Cohen, C. , Li, Y. , Mui, S. , Reshetnikova, L. , Strand, J. , Tobacman, L.S.
Method: X-RAY DIFFRACTION Resolution: 2.7 Å
Crystal structure of the c-terminal region of striated muscle alpha-tropomyosin at 2.7 angstrom resolution
Brown, J.H. , Cohen, C. , Li, Y. , Mui, S. , Reshetnikova, L. , Strand, J. , Tobacman, L.S.
Primary Citation of Related Structures: 1KQL
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Fusion Protein of and striated muscle alpha-tropomyosin and the GCN4 leucine zipper | A | 56 | Rattus Norvegicus , Saccharomyces Cerevisiae | MDKVEELLSKNYHLENEVARLKKLVDDLEDELYAQKLKYKAISEELDHALNDMTSI |
| Fusion Protein of and striated muscle alpha-tropomyosin and the GCN4 leucine zipper | B | 56 | Rattus Norvegicus , Saccharomyces Cerevisiae | MDKVEELLSKNYHLENEVARLKKLVDDLEDELYAQKLKYKAISEELDHALNDMTSI |
Method: X-RAY DIFFRACTION
Deposited Date: 2002-01-07 Deposition Author(s): Brown, J.H. , Cohen, C. , Li, Y. , Mui, S. , Reshetnikova, L. , Strand, J. , Tobacman, L.S.