Nmr structure of dff-c domain
PDB DOI: 10.2210/pdb1koy/pdb
Classification: APOPTOSIS Organism(s): Salmonella Enterica
Deposited: 2001-12-25 Deposition Author(s): Fukushima, K. , Kigawa, T. , Kikuchi, J. , Koshiba, S. , Kuroda, Y. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Yokoyama, S.
Method: SOLUTION NMR Resolution: N.A.
Nmr structure of dff-c domain
Fukushima, K. , Kigawa, T. , Kikuchi, J. , Koshiba, S. , Kuroda, Y. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Yokoyama, S.
Primary Citation of Related Structures: 1KOY
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
DNA fragmentation factor alpha subunit | A | 62 | Salmonella Enterica | SHILTALREKQAPELSLSSQDLELVTKEDPKALAVALNWDIKKTETVQEACERELALRLQQT |
Method: SOLUTION NMR
Deposited Date: 2001-12-25 Deposition Author(s): Fukushima, K. , Kigawa, T. , Kikuchi, J. , Koshiba, S. , Kuroda, Y. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Yokoyama, S.