1KC2
Structure of the triple (lys(beta)d3ala, asp(beta)c8ala, aspcd2ala) mutant of the src sh2 domain bound to the pqpyeeipi peptide
PDB DOI: 10.2210/pdb1kc2/pdb
Classification: TRANSFERASE Organism(s): Parvibaculum Lavamentivorans (Strain Ds-1 / Dsm 13023 / Ncimb 13966) , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2001-11-07 Deposition Author(s): Lubman, O.Y. , Waksman, G.
Experimental Data Snapshot
Method: X-RAY DIFFRACTION Resolution: 2.1 Å
Structure of the triple (lys(beta)d3ala, asp(beta)c8ala, aspcd2ala) mutant of the src sh2 domain bound to the pqpyeeipi peptide
Primary Citation of Related Structures: 1KC2
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Src Tyrosine kinase | A | 103 | Parvibaculum Lavamentivorans (Strain Ds-1 / Dsm 13023 / Ncimb 13966) , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | AEEWYFGKITRRESERLLLNPENPRGTFLVRESETTKGAYCLSVSAFANAKGLNVAHYKIRKLDSGGFYITSRTQFSSLQQLVAYYSKHADGLCHRLTNVCPT |
| PQpYEEIPI peptide | B | 8 | Parvibaculum Lavamentivorans (Strain Ds-1 / Dsm 13023 / Ncimb 13966) , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | PQYEEIPI |
Experimental Data
Method: X-RAY DIFFRACTION
Deposited Date: 2001-11-07 Deposition Author(s): Lubman, O.Y. , Waksman, G.