Three-dimensional solution structure of apo-s100a1.
PDB DOI: 10.2210/pdb1k2h/pdb
Classification: METAL BINDING PROTEIN Organism(s): Rattus Norvegicus
Deposited: 2001-09-27 Deposition Author(s): Baldisseri, D.M. , Hamilton, S.M. , Inman, K.G. , Landar, A. , Landar, A. , Nizner, P. , Rustandi, R.R. , Weber, D.J. , Zimmer, D.B.
Three-dimensional solution structure of apo-s100a1.
Baldisseri, D.M. , Hamilton, S.M. , Inman, K.G. , Landar, A. , Landar, A. , Nizner, P. , Rustandi, R.R. , Weber, D.J. , Zimmer, D.B.
Primary Citation of Related Structures: 1K2H
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| S-100 protein, alpha chain | A | 93 | Rattus Norvegicus | GSELETAMETLINVFHAHSGKEGDKYKLSKKELKDLLQTELSSFLDVQKDADAVDKIMKELDENGDGEVDFQEFVVLVAALTVACNNFFWENS |
| S-100 protein, alpha chain | B | 93 | Rattus Norvegicus | GSELETAMETLINVFHAHSGKEGDKYKLSKKELKDLLQTELSSFLDVQKDADAVDKIMKELDENGDGEVDFQEFVVLVAALTVACNNFFWENS |
Method: SOLUTION NMR
Deposited Date: 2001-09-27 Deposition Author(s): Baldisseri, D.M. , Hamilton, S.M. , Inman, K.G. , Landar, A. , Landar, A. , Nizner, P. , Rustandi, R.R. , Weber, D.J. , Zimmer, D.B.