Nmr structures of the zinc finger domain of human dna polymerase-alpha
PDB DOI: 10.2210/pdb1k0p/pdb
Classification: TRANSFERASE Organism(s): N.A.
Deposited: 2001-09-20 Deposition Author(s): Basu, S. , Bose, R.N. , Evanics, F. , Yang, W.W.
Nmr structures of the zinc finger domain of human dna polymerase-alpha
Basu, S. , Bose, R.N. , Evanics, F. , Yang, W.W.
Primary Citation of Related Structures: 1K0P
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| DNA polymerase alpha catalytic subunit | A | 31 | N.A. | ICEEPTCRNRTRHLPLQFSRTGPLCPACMKA |
Method: SOLUTION NMR
Deposited Date: 2001-09-20 Deposition Author(s): Basu, S. , Bose, R.N. , Evanics, F. , Yang, W.W.