I53a, a point mutant of the cysteine-free variant of e. coli rnase hi
PDB DOI: 10.2210/pdb1jxb/pdb
Classification: HYDROLASE Organism(s): Escherichia Coli
Deposited: 2001-09-06 Deposition Author(s): Lorenz, S. , Marqusee, S. , Spudich, G.
I53a, a point mutant of the cysteine-free variant of e. coli rnase hi
Lorenz, S. , Marqusee, S. , Spudich, G.
Primary Citation of Related Structures: 1JXB
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Ribonuclease HI | A | 155 | Escherichia Coli | MLKQVEIFTDGSALGNPGPGGYGAILRYRGREKTFSAGYTRTTNNRMELMAAAVALEALKEHAEVILSTDSQYVRQGITQWIHNWKKRGWKTADKKPVKNVDLWQRLDAALGQHQIKWEWVKGHAGHPENERADELARAAAMNPTLEDTGYQVEV |
Method: X-RAY DIFFRACTION
Deposited Date: 2001-09-06 Deposition Author(s): Lorenz, S. , Marqusee, S. , Spudich, G.