Crystal structure analysis of the sh2 domain of the csk homologous kinase chk
PDB DOI: 10.2210/pdb1jwo/pdb
Classification: TRANSFERASE Organism(s): Homo Sapiens
Deposited: 2001-09-04 Deposition Author(s): Murthy, T.V.S. , Webster, G.D.
Method: X-RAY DIFFRACTION Resolution: 2.5 Å
Crystal structure analysis of the sh2 domain of the csk homologous kinase chk
Murthy, T.V.S. , Webster, G.D.
Primary Citation of Related Structures: 1JWO
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Csk Homologous Kinase | A | 97 | Homo Sapiens | LSLMPWFHGKISGQEAVQQLQPPEDGLFLVRESARHPGDYVLCVSFGRDVIHYRVLHRDGHLTIDEAVFFCNLMDMVEHYSKDKGAICTKLVRPKRK |
Method: X-RAY DIFFRACTION
Deposited Date: 2001-09-04 Deposition Author(s): Murthy, T.V.S. , Webster, G.D.