Solution structure of the cytoplasmic n-terminus of the bk beta-subunit kcnmb2
PDB DOI: 10.2210/pdb1jo6/pdb
Classification: METAL TRANSPORT, MEMBRANE PROTEIN Organism(s): N.A.
Deposited: 2001-07-27 Deposition Author(s): Bentrop, D. , Beyermann, M. , Fakler, B. , Wissmann, R.
Solution structure of the cytoplasmic n-terminus of the bk beta-subunit kcnmb2
Bentrop, D. , Beyermann, M. , Fakler, B. , Wissmann, R.
Primary Citation of Related Structures: 1JO6
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
potassium large conductance calcium-activated channel, subfamily M, beta member 2 | A | 45 | N.A. | MFIWTSGRTSSSYRHDEKRNIYQKIRDHDLLDKRKTVTALKAGED |
Method: SOLUTION NMR
Deposited Date: 2001-07-27 Deposition Author(s): Bentrop, D. , Beyermann, M. , Fakler, B. , Wissmann, R.