Solution structure of the viscotoxin a2
PDB DOI: 10.2210/pdb1jmn/pdb
Classification: TOXIN Organism(s): Burkholderia Gladioli (Strain Bsr3)
Deposited: 2001-07-19 Deposition Author(s): Bernard, C. , Coulon, A. , Darbon, H. , Mosbah, A. , Rouge, P. , Urech, K.
Method: SOLUTION NMR Resolution: N.A.
Solution structure of the viscotoxin a2
Bernard, C. , Coulon, A. , Darbon, H. , Mosbah, A. , Rouge, P. , Urech, K.
Primary Citation of Related Structures: 1JMN
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
viscotoxin A2 | A | 46 | Burkholderia Gladioli (Strain Bsr3) | KSCCPNTTGRNIYNTCRFGGGSRQVCASLSGCKIISASTCPSDYPK |
Method: SOLUTION NMR
Deposited Date: 2001-07-19 Deposition Author(s): Bernard, C. , Coulon, A. , Darbon, H. , Mosbah, A. , Rouge, P. , Urech, K.