Testing the water-mediated hin recombinase dna recognition by systematic mutations.
PDB DOI: 10.2210/pdb1jj6/pdb
Classification: DNA BINDING PROTEIN/DNA Organism(s): N.A.
Deposited: 2001-07-03 Deposition Author(s): Chiu, T.K. , Dickerson, R.E. , Johnson, R.C. , Sohn, C.
Testing the water-mediated hin recombinase dna recognition by systematic mutations.
Chiu, T.K. , Dickerson, R.E. , Johnson, R.C. , Sohn, C.
Primary Citation of Related Structures: 1JJ6
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| DNA-INVERTASE HIN | C | 52 | N.A. | GRPRAINKHEQEQISRLLEKGHPRQQLAIIFGIGVSTLYRYFPASSIKKRMN |
Method: X-RAY DIFFRACTION
Deposited Date: 2001-07-03 Deposition Author(s): Chiu, T.K. , Dickerson, R.E. , Johnson, R.C. , Sohn, C.