Crystal structure of bleomycin-binding protein from bleomycin-producing streptomyces verticillus complexed with metal-free bleomycin
PDB DOI: 10.2210/pdb1jie/pdb
Classification: PROTEIN BINDING Organism(s): Streptomyces Verticillus
Deposited: 2001-07-02 Deposition Author(s): Hayashida, M. , Kumagai, T. , Maruyama, M. , Matoba, Y. , Sugiyama, M.
Crystal structure of bleomycin-binding protein from bleomycin-producing streptomyces verticillus complexed with metal-free bleomycin
Hayashida, M. , Kumagai, T. , Maruyama, M. , Matoba, Y. , Sugiyama, M.
Primary Citation of Related Structures: 1JIE
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| bleomycin-binding protein | A | 122 | Streptomyces Verticillus | MVKFLGAVPVLTAVDVPANVSFWVDTLGFEKDFGDRDFAGVRRGDIRLHISRTEHQIVADNTSAWIEVTDPDALHEEWARAVSTDYADTSGPAMTPVGESPAGREFAVRDPAGNCVHFTAGE |
| bleomycin-binding protein | B | 122 | Streptomyces Verticillus | MVKFLGAVPVLTAVDVPANVSFWVDTLGFEKDFGDRDFAGVRRGDIRLHISRTEHQIVADNTSAWIEVTDPDALHEEWARAVSTDYADTSGPAMTPVGESPAGREFAVRDPAGNCVHFTAGE |
Method: X-RAY DIFFRACTION
Deposited Date: 2001-07-02 Deposition Author(s): Hayashida, M. , Kumagai, T. , Maruyama, M. , Matoba, Y. , Sugiyama, M.