Solution structure of the monomeric [thr(b27)->pro,pro(b28)->thr] insulin mutant (pt insulin)
PDB DOI: 10.2210/pdb1jco/pdb
Classification: HORMONE/GROWTH FACTOR Organism(s): Homo Sapiens
Deposited: 2001-06-11 Deposition Author(s): Clausen, R. , Josefsen, K. , Keller, D. , Led, J.J.
Solution structure of the monomeric [thr(b27)->pro,pro(b28)->thr] insulin mutant (pt insulin)
Clausen, R. , Josefsen, K. , Keller, D. , Led, J.J.
Primary Citation of Related Structures: 1JCO
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Insulin A chain | A | 21 | Homo Sapiens | GIVEQCCTSICSLYQLENYCN |
Insulin B chain | B | 30 | Homo Sapiens | FVNQHLCGSHLVEALYLVCGERGFFYPTKT |
Method: SOLUTION NMR
Deposited Date: 2001-06-11 Deposition Author(s): Clausen, R. , Josefsen, K. , Keller, D. , Led, J.J.