Advanced Search:
1J5K
Complex of the kh3 domain of hnrnp k with a single_stranded 10mer dna oligonucleotide
PDB DOI: 10.2210/pdb1j5k/pdb
Classification: TRANSCRIPTION/DNA Organism(s): Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2002-05-13 Deposition Author(s): Braddock, D.T. , Clore, G.M.
Experimental Data Snapshot
Method: SOLUTION NMR Resolution: N.A.
Complex of the kh3 domain of hnrnp k with a single_stranded 10mer dna oligonucleotide
Primary Citation of Related Structures: 1J5K
| Nucleic Acids / Hybrid | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| 5'-D(*AP*TP*AP*T*TP*CP*CP*CP*TP*C)-3' | b | 10 | NA | ATATTCCCTC |
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Heterogeneous nuclear ribonucleoprotein K | A | 89 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | GSHMSYGDLGGPIITTQVTIPKDLAGSIIGKGGQRIKQIRHESGASIKIDEPLEGSEDRIITITGTQDQIQNAQYLLQNSVKQYSGKFF |
Experimental Data
Method: SOLUTION NMR
Deposited Date: 2002-05-13 Deposition Author(s): Braddock, D.T. , Clore, G.M.