The crystal structure of ca+-bound human s100p determined at 2.0a resolution by x-ray
PDB DOI: 10.2210/pdb1j55/pdb
Classification: METAL BINDING PROTEIN Organism(s): Homo Sapiens
Deposited: 2002-01-25 Deposition Author(s): Barraclough, R. , Ding, Y. , Fernig, D.G. , Rao, Z. , Rudland, P.S. , Wang, G. , Wang, Z. , Zhang, H.
The crystal structure of ca+-bound human s100p determined at 2.0a resolution by x-ray
Barraclough, R. , Ding, Y. , Fernig, D.G. , Rao, Z. , Rudland, P.S. , Wang, G. , Wang, Z. , Zhang, H.
Primary Citation of Related Structures: 1J55
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| S-100P PROTEIN | A | 95 | Homo Sapiens | MTELETAMGMIIDVFSRYSGSEGSTQTLTKGELKVLMEKELPGFLQSGKDKDAVDKLLKDLDANGDAQVDFSEFIVFVAAITSACHKYFEKAGLK |
Method: X-RAY DIFFRACTION
Deposited Date: 2002-01-25 Deposition Author(s): Barraclough, R. , Ding, Y. , Fernig, D.G. , Rao, Z. , Rudland, P.S. , Wang, G. , Wang, Z. , Zhang, H.