Solution structure of the n-terminal domain of the hmgb2
PDB DOI: 10.2210/pdb1j3x/pdb
Classification: DNA BINDING PROTEIN Organism(s): Sus Scrofa
Deposited: 2003-02-19 Deposition Author(s): Kurita, J. , Shimahara, H. , Tate, S. , Yoshida, M.
Solution structure of the n-terminal domain of the hmgb2
Kurita, J. , Shimahara, H. , Tate, S. , Yoshida, M.
Primary Citation of Related Structures: 1J3X
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| High mobility group protein 2 | A | 77 | Sus Scrofa | MGKGDPNKPRGKMSSYAFFVQTSREEHKKKHPDSSVNFAEFSKKCSERWKTMSAKEKSKFEDMAKSDKARYDREMKN |
Method: SOLUTION NMR
Deposited Date: 2003-02-19 Deposition Author(s): Kurita, J. , Shimahara, H. , Tate, S. , Yoshida, M.