1J3E
Crystal structure of the e.coli seqa protein complexed with n6-methyladenine- guanine mismatch dna
PDB DOI: 10.2210/pdb1j3e/pdb
Classification: REPLICATION/DNA Organism(s): Adineta Vaga , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2003-01-24 Deposition Author(s): Fujikawa, N. , Hiraga, S. , Kurumizaka, H. , Nureki, O. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Tanaka, Y. , Yamazoe, M. , Yokoyama, S.
Experimental Data Snapshot
Method: X-RAY DIFFRACTION Resolution: 2.5 Å
Crystal structure of the e.coli seqa protein complexed with n6-methyladenine- guanine mismatch dna
Fujikawa, N. , Hiraga, S. , Kurumizaka, H. , Nureki, O. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Tanaka, Y. , Yamazoe, M. , Yokoyama, S.
Primary Citation of Related Structures: 1J3E
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| SeqA protein | A | 115 | Adineta Vaga , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | PLGSAMRELLLSDEYAEQKRAVNRFMLLLSTLYSLDAQAFAEATESLHGRTRVYFAADEQTLLKNGNQTKPKHVPGTPYWVITNTNTGRKCSMIEHIMQSMQFPAELIEKVCGTI |
Experimental Data
Method: X-RAY DIFFRACTION
Deposited Date: 2003-01-24 Deposition Author(s): Fujikawa, N. , Hiraga, S. , Kurumizaka, H. , Nureki, O. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Tanaka, Y. , Yamazoe, M. , Yokoyama, S.