Crystal structure of rap74 c-terminal domain complexed with fcp1 c-terminal peptide
PDB DOI: 10.2210/pdb1j2x/pdb
Classification: TRANSCRIPTION Organism(s): Homo Sapiens , Synthetic Construct
Deposited: 2003-01-15 Deposition Author(s): Burley, S.K. , Kamada, K. , Roeder, R.G.
Method: X-RAY DIFFRACTION Resolution: 2 Å
Crystal structure of rap74 c-terminal domain complexed with fcp1 c-terminal peptide
Burley, S.K. , Kamada, K. , Roeder, R.G.
Primary Citation of Related Structures: 1J2X
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Transcription initiation factor IIF, alpha subunit | A | 73 | Homo Sapiens , Synthetic Construct | GPLGSGDVQVTEDAVRRYLTRKPMTTKDLLKKFQTKKTGLSSEQTVNVLAQILKRLNPERKMINDKMHFSLKE |
| RNA polymerase II CTD phosphatase | B | 18 | Homo Sapiens , Synthetic Construct | SEADEMAKALEAELNDLM |
Method: X-RAY DIFFRACTION
Deposited Date: 2003-01-15 Deposition Author(s): Burley, S.K. , Kamada, K. , Roeder, R.G.