The solution structure of the third kunitz domain of tissue factor pathway inhibitor
PDB DOI: 10.2210/pdb1irh/pdb
Classification: PROTEIN BINDING Organism(s): Salmonella Enterica
Deposited: 2001-10-02 Deposition Author(s): Hara, S. , Kato, H. , Mine, S. , Miyata, T. , Yamazaki, T.
The solution structure of the third kunitz domain of tissue factor pathway inhibitor
Hara, S. , Kato, H. , Mine, S. , Miyata, T. , Yamazaki, T.
Primary Citation of Related Structures: 1IRH
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
tissue factor pathway inhibitor | A | 61 | Salmonella Enterica | EFHGPSWCLTPADRGLCRANENRFYYNSVIGKCRPFKYSGCGGNENNFTSKQECLRACKKG |
Method: SOLUTION NMR
Deposited Date: 2001-10-02 Deposition Author(s): Hara, S. , Kato, H. , Mine, S. , Miyata, T. , Yamazaki, T.