Human apolipoprotein c-i, nmr, 18 structures
PDB DOI: 10.2210/pdb1ioj/pdb
Classification: APOLIPOPROTEIN Organism(s): N.A.
Deposited: 1998-05-12 Deposition Author(s): Cushley, R.J. , Rozek, A. , Sparrow, J.T. , Weisgraber, K.H.
Human apolipoprotein c-i, nmr, 18 structures
Cushley, R.J. , Rozek, A. , Sparrow, J.T. , Weisgraber, K.H.
Primary Citation of Related Structures: 1IOJ
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| APOC-I | A | 57 | N.A. | TPDVSSALDKLKEFGNTLEDKARELISRIKQSELSAKMREWFSETFQKVKEKLKIDS |
Method: SOLUTION NMR
Deposited Date: 1998-05-12 Deposition Author(s): Cushley, R.J. , Rozek, A. , Sparrow, J.T. , Weisgraber, K.H.