Solution structure of human il-13
PDB DOI: 10.2210/pdb1ijz/pdb
Classification: CYTOKINE Organism(s): Homo Sapiens
Deposited: 2001-05-01 Deposition Author(s): Diblasio, E. , Moy, F.J. , Powers, R. , Wilhelm, J.
Method: SOLUTION NMR Resolution: N.A.
Solution structure of human il-13
Diblasio, E. , Moy, F.J. , Powers, R. , Wilhelm, J.
Primary Citation of Related Structures: 1IJZ
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| INTERLEUKIN-13 | A | 113 | Homo Sapiens | MGPVPPSTALRELIEELVNITQNQKAPLCNGSMVWSINLTAGMYCAALESLINVSGCSAIEKTQRMLSGFCPHKVSAGQFSSLHVRDTKIEVAQFVKDLLLHLKKLFREGRFN |
Method: SOLUTION NMR
Deposited Date: 2001-05-01 Deposition Author(s): Diblasio, E. , Moy, F.J. , Powers, R. , Wilhelm, J.