1IIO
Nmr-based structure of the conserved protein mth865 from the archea methanobacterium thermoautotrophicum
PDB DOI: 10.2210/pdb1iio/pdb
Classification: STRUCTURAL GENOMICS, UNKNOWN FUNCTION Organism(s): Methanothermobacter Thermautotrophicus Str. Delta H
Deposited: 2001-04-23 Deposition Author(s): Arrowsmith, C.H. , Edwards, A.M. , Lee, G.M. , Mcintosh, L.P.
Experimental Data Snapshot
Method: SOLUTION NMR Resolution: N.A.
Nmr-based structure of the conserved protein mth865 from the archea methanobacterium thermoautotrophicum
Arrowsmith, C.H. , Edwards, A.M. , Lee, G.M. , Mcintosh, L.P.
Primary Citation of Related Structures: 1IIO
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| conserved hypothetical protein MTH865 | A | 84 | Methanothermobacter Thermautotrophicus Str. Delta H | GSHMKMGVKEDIRGQIIGALAGADFPINSPEELMAALPNGPDTTCKSGDVELKASDAGQVLTADDFPFKSAEEVADTIVNKAGL |
Experimental Data
Method: SOLUTION NMR
Deposited Date: 2001-04-23 Deposition Author(s): Arrowsmith, C.H. , Edwards, A.M. , Lee, G.M. , Mcintosh, L.P.